PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10026620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 293aa    MW: 31738.1 Da    PI: 9.8613
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10026620genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.43.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ +++ g+ R++k+c++rw +yl
      Lus10026620 14 KGPWTPEEDQKLLAYIEKHGHGSWRALPAKAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.11.5e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia+++  +Rt++++k++w+++l
      Lus10026620  67 RGKFSLQEEQTIIQLHALLGNR-WAAIASHLD-KRTDNEIKNHWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-25564IPR009057Homeodomain-like
PROSITE profilePS5129424.216965IPR017930Myb domain
SuperFamilySSF466894.4E-3111108IPR009057Homeodomain-like
SMARTSM007171.8E-141363IPR001005SANT/Myb domain
PfamPF002496.0E-171461IPR001005SANT/Myb domain
CDDcd001675.27E-121661No hitNo description
Gene3DG3DSA:1.10.10.603.6E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129420.78466116IPR017930Myb domain
SMARTSM007175.6E-1666114IPR001005SANT/Myb domain
PfamPF002491.3E-1567112IPR001005SANT/Myb domain
CDDcd001674.54E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MVRSPCCQKV GLKKGPWTPE EDQKLLAYIE KHGHGSWRAL PAKAGLQRCG KSCRLRWTNY  60
LRPDSKRGKF SLQEEQTIIQ LHALLGNRWA AIASHLDKRT DNEIKNHWNT HLKKRLERMG  120
IDPATHKPKT PITMDANGHY NSSKEAATLS HMAQWESARL EAEARLVRES IPKIKPPNNN  180
NNNKCPPSVR SKSSTSRPIC LDVLRAWQGL IGDNDKDGSA SSLESPTSIL NFPPADVPPP  240
PTGDELAVSV GGVIWSPVVI PGFGDGGISD VVLGTGSPAG AGAGAGXXXX VM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27121175109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002316122.11e-115hypothetical protein POPTR_0010s17300g
TrEMBLB9HXX61e-115B9HXX6_POPTR; Uncharacterized protein
STRINGPOPTR_0010s17300.11e-115(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.15e-98myb domain protein 16